English to Shona Meaning of anticlimactic


Anticlimactic :
(coming after the climax especially of a dramatic or narrative plot) "everything after the discovery of the murderer was anticlimactic"anticlimactical (of or relating to a sudden change from an impressive to a ludicrous style) Facebook Twitter Linkedin Gmail Share More
Climactic :
usingakanganwiki
- usingakanganwikianticlimacticpanyanga
 

Show English Meaning
(+)

Adjective(1) consisting of or causing a climax

Show Examples
(+)

(1) The downside's that after such a climactic event, there's still an hour to go.(2) Some of the best moments in the film include Napoleon's climactic dance scene that wins Pedro the high school election.(3) The climactic action sequence is nothing like anything that occurred in the first weeks of the Normandy invasion.(4) To say whether she does would give away the details of a climactic scene which has to be seen to be believed.(5) The World Cup is one coherent drama with developing conflict, mounting tension and a climactic resolution.(6) The climactic event, however, consists of tying the captive condor by its feet onto the back of a bull.(7) The climactic scene in which the local Mafiosi close in on the inspector is bone chilling and unforgettable.(8) This turns out not to be a casual device but, in the climactic scene, intrinsic to the film.(9) And the final climactic emotional moment is cringe inducing rather than searingly moving.(10) The world champions were empty after a dramatic, climactic finish that meant the trophy was shared.(11) In another climactic event, Vronsky loses a horserace he is slated to win.(12) That said, it doesn't entirely work dramatically, and the play falters as it reaches its climactic final moments.(13) In one climactic scene, he is publicly and sadistically humiliated by the king.(14) The lead-in to the climactic scene is nothing compared to the original.(15) The fair's climactic event, the demolition derby, is drawing big crowds to the fairgrounds.(16) Troy is at its best in the climactic fight scene between Hector and Achilles, and its aftermath.
Synonyms
Adjective
1. final ::
yokupedzisira
2. ending ::
kuzviuraya
3. closing ::
Kuvharwa
5. ultimate ::
chivavarirwa
6. exciting ::
fadza
9. riveting ::
riveting
10. dramatic ::
zvinoshamisa
11. hair-raising ::
bvudzi-rinoti
12. crucial ::
inokosha
13. decisive ::
kusarudza
14. critical ::
dzinonetsa
Different Forms
anticlimactic, climactic
Word Example from TV Shows

The best way to learn proper English is to read news report, and watch news on TV. Watching TV shows is a great way to learn casual English, slang words, understand culture reference and humor. If you have already watched these shows then you may recall the words used in the following dialogs.

Just... feels
a little anticlimactic.

Just... feels a little ANTICLIMACTIC.

The Big Bang Theory Season 7, Episode 23


You know what wasn't anti-climactic?
The end of the movie! Get this.

You know what wasn't anti-climactic? The end of the movie! Get this.

The Big Bang Theory Season 9, Episode 19


Well, this is kinda anti-climactic.

Well, this is kinda anti-climactic.

The Big Bang Theory Season 9, Episode 19


English to Shona Dictionary: anticlimactic

Meaning and definitions of anticlimactic, translation in Shona language for anticlimactic with similar and opposite words. Also find spoken pronunciation of anticlimactic in Shona and in English language.

Tags for the entry 'anticlimactic'

What anticlimactic means in Shona, anticlimactic meaning in Shona, anticlimactic definition, examples and pronunciation of anticlimactic in Shona language.

Shona.English-Dictionary.Help | English to Shona Dictionary

This is not just an ordinary English to Shona dictionary & Shona to English dictionary. This dictionary has the largest database for word meaning. It does not only give you English toShona and Shona to English word meaning, it provides English to English word meaning along with Antonyms, Synonyms, Examples, Related words and Examples from your favorite TV Shows. This dictionary helps you to search quickly for Shona to English translation, English to Shona translation. It has more than 500,000 word meaning and is still growing. This English to Shona dictionary also provides you an Android application for your offline use. The dictionary has mainly three features : translate English words to Shona translate Shona words to English, copy & paste any paragraph in the Reat Text box then tap on any word to get instant word meaning. This website also provides you English Grammar, TOEFL and most common words.
Learn Prepositions by Photos
Commonly confused words
form of verbs
Learn 300+ TOEFL words
Fill in the blanks
Topic Wise Words
Learn 3000+ common words
Words Everyday
Most Searched Words
GRE words
Android App
iPhone App
Chrome Extension

Blog List

Topic Wise Words

Learn 3000+ Common Words

Learn Common GRE Words

Learn Words Everyday

Your Favorite Words
Currently you do not have any favorite word. To make a word favorite you have to click on the heart button.
Your Search History
All Dictionary Links